PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.788L8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB
Protein Properties Length: 352aa    MW: 39852.7 Da    PI: 6.4004
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.788L8genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.36.6e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEd ++v  v ++G+ +W++++++ g++R++k+c+ rw +yl
      Araip.788L8 14 RGVWSPEEDAKIVAFVSKHGPSNWTSVPKKAGLKRCGKSCRFRWTNYL 61
                     899*******************************************97 PP

2Myb_DNA-binding414.4e-1369110346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       +T +E++l++++++  G++ W  Ia+ ++ gRt++++k++w++
      Araip.788L8  69 TFTSQEEDLIIKLHAAIGSR-WFIIAQQLP-GRTDNDVKNYWNT 110
                      79******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.6E-22564IPR009057Homeodomain-like
PROSITE profilePS5129425.26965IPR017930Myb domain
SuperFamilySSF466891.8E-2811108IPR009057Homeodomain-like
SMARTSM007173.7E-141363IPR001005SANT/Myb domain
PfamPF002491.1E-151461IPR001005SANT/Myb domain
CDDcd001671.64E-101761No hitNo description
Gene3DG3DSA:1.10.10.602.8E-2265116IPR009057Homeodomain-like
PROSITE profilePS5129415.91866116IPR017930Myb domain
SMARTSM007172.0E-1266114IPR001005SANT/Myb domain
CDDcd001671.71E-869112No hitNo description
PfamPF002497.2E-1269110IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MVRSQCYDKI SVKRGVWSPE EDAKIVAFVS KHGPSNWTSV PKKAGLKRCG KSCRFRWTNY  60
LRPDLKQDTF TSQEEDLIIK LHAAIGSRWF IIAQQLPGRT DNDVKNYWNT KLKKKLSQMG  120
IDPVTHKPFS KLIADYGNIE GSHSQKPTNQ TSFINNKDLK RSSILLNAEP YQTLKPQGVI  180
SRITNNNNSQ QQTLQMEPIT DKTNLSFNSL TDLTMMPTVI GSTDCCIETE NETITCSSSS  240
SCSTPDQDAS PVASHFRWND FLLEDAFVPT ADNNDQEMVK AGFLSKELLV CRIENVSRQS  300
WNNKEAISND FQLSSSSSSS SSYETSFVEA MLDQENEMFL NFPHLMEEPS HY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-271411627128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016199942.10.0PREDICTED: transcription factor MYB35-like
TrEMBLA0A0B2QGM51e-111A0A0B2QGM5_GLYSO; Myb-related protein Zm38
STRINGGLYMA06G20020.21e-102(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.11e-65MYB family protein